princessejcalon007 princessejcalon007

10-12-2021
Mathematics

contestada

Select all the expressions that equal:

-7 - (- 12)

below:

Select all the expressions that equal 7 12 below class=

Respuesta :

loneguy loneguy

10-12-2021

Answer:

c and e

Step-by-step explanation:

[tex]-7-(-12) = -7 +12 = 12 +(-7)[/tex]

Answer Link

Otras preguntas

Multiply.0.64x 12.55

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

What is the molecular shape of a Cl2CO molecule? A) Linear B) Tetrahedral C) Trigonal planar D) Trigonal pyramidal E) Bent

What are three ways that Earth got its water?

The difference of two positive numbers is 13. The larger number is nine less than twice the smaller number. Find the numbers. The numbers are

what was the tool sumerians used to write called

SOMEONE PLEASEEEE HELPP

BRAINLIEST !!! HOW MANY BURGERS CAN YOU MAKE WITH 1 BILLION BURGERS ?? each cow can make 1,200 burgers ! explain

How subduction cause the formation of land mass like mountains and volcano?

7. The price of a taxi ride starts at $3.00 and costs $0.20 per mile after that. How much would a 25-mile ride cost?